
Clinical Cancer Research Vol. 12, 3803-3813, June 15, 2006
© 2006 American Association for Cancer Research
Cancer Therapy: Preclinical |
Carcinoembryonic AntigenTargeted Selective Gene Therapy for Gastric Cancer through FZ33 Fiber-Modified Adenovirus Vectors
Toshihiro Tanaka1,3,
Jianhua Huang1,
Sachie Hirai1,
Motomu Kuroki4,
Masahide Kuroki4,
Naoki Watanabe2,
Kei Tomihara1,
Kazunori Kato1 and
Hirofumi Hamada1
Authors' Affiliations: Departments of 1 Molecular Medicine and 2 Clinical Laboratory Medicine, Sapporo Medical University, Sapporo, Japan and Departments of 3 Surgery I and 4 Biochemistry, School of Medicine, Fukuoka University, Fukuoka, Japan
Requests for reprints: Hirofumi Hamada, Department of Molecular Medicine, Sapporo Medical University, South-1, West-17, Chuo-ku, Sapporo 060-8556, Japan. Phone: 81-11-611-2111; Fax: 81-11-611-2136; E-mail: hhamada{at}sapmed.ac.jp.
 |
Abstract
|
|---|
Purpose: A major problem when using the adenoviral vectors for gene therapy applications is thought to be related to low transduction efficiency in cancer cells or to side effects in normal cells. There is an urgent requirement to improve the specificity of gene delivery in the context of cancer gene therapy.
Experimental Design: We constructed a genetically modified adenovirus incorporating an IgG Fc-binding motif from the Staphylococcus protein A, Z33, within the HI loop (Adv-FZ33). A remarkable degree of targeted gene delivery to gastric cancer cells was obtained with Adv-FZ33 with the fully human anticarcinoembryonic antigen (CEA) monoclonal antibody, C2-45.
Results: In vitro LacZ or EGFP gene expression after Adv-FZ33 infection via C2-45 was 20 times higher than control monoclonal antibody in MKN-45 at 1,000 viral particles/cell. We generated Ax3CAUP-FZ33 (UP-FZ33), which is an Adv-FZ33 derivative vector expressing a therapeutic gene (i.e., Escherichia coli uracil phosphoribosyltransferase), which converts 5-fluorouracil (5-FU) directly to 5-fluoro-UMP. UP-FZ33 with C2-45 enhanced the cytotoxicity of 5-FU by 10.5-fold in terms of IC50 against MKN-45 compared with control IgG4. In a nude mouse peritoneal dissemination model, tumor growth in mice treated with UP-FZ33/C2-45/5-FU was significantly suppressed, and tumor volumes were less than one-fourth of those of the control IgG4 group (P < 0.05). The median survival time of the UP-FZ33/C2-45/5-FU group was significantly longer than those treated with PBS or 5-FU only (P < 0.01).
Conclusions: These data suggest that CEA-targeted FZ33 mutant adenovirus-mediated gene delivery offers a strong and selective therapeutic modality against CEA-producing cancers.
Disseminated peritoneal gastric cancer does not generally respond to current treatments, such as surgery, chemotherapy, and radiotherapy (1, 2). There is, therefore, considerable interest in the development of new therapeutic approaches. In this context, gene therapy offers a potentially valuable, alternative means of treating advanced gastric cancer.
At present, adenoviral vectors have been widely used for gene transfer into tumor cells primarily because they can be produced in high titers and can infect many different cell types (3). Adenovirus serotype 5 infection is mediated by the high-affinity binding of the fiber knob to the coxsackie-adenovirus receptor (CAR; refs. 46) followed by internalization mediated by the binding of RGD motifs in the penton base to integrins
vß3 and
vß5 on the cell surface (4, 7, 8). However, widespread application of adenoviral vectors for cancer gene therapy is hampered by a lack of specificity for malignant cells, as the CAR is expressed on both normal and malignant cells (4). Therefore, the development of tropism-modified, tumor-targeted adenoviral vectors is a critical issue in further developing the cancer gene therapy approach. In recent years, adenoviral tropism can be modified to retarget adenovirus serotype 5 to alternate receptors, thereby rendering viral infection CAR independent. We noticed a strategy that IgG-binding domain (Z33), derived from staphylococcal protein A, was inserted into the adenoviral fiber protein (9, 10). The fiber retained the ability to assemble into trimers, bound IgG with high affinity, and was incorporated into vector particles.
The human carcinoembryonic antigen (CEA) gene family is a group of highly glycosylated homotypic/heterotypic cell surface and intercellular adhesion molecules that belong to the immunoglobulin gene superfamily (11). CEA is expressed on the surface of
95% of human cancer cells as well as on the epithelial cells of normal gastrointestinal tissue and the fetal intestine (12, 13). However, in normal adult tissues, CEA is localized on the luminal side of the columnar epithelial cells (14), so that the antigen does not directly face blood or tissue fluid (13, 15). Tumor CEA may therefore be a viable target for adenoviral-mediated gene therapy. However, major problems occurred when a mouse anti-CEA antibody was used as an anticancer agent in clinical trials due to cross-reactivity of the monoclonal antibody (mAb) with normal tissues and also because of an immunogenic response against the mouse mAb (16, 17). The CEA family consists of seven expressed genes (13, 18). Among these, CEACAM1, CEACAM6, and CEACAM8 are quite impedimental in terms of targeting because they are also often expressed in various normal tissues (1822). To circumvent this problem, we established novel fully human-specific CEA mAbs against tumor CEA (1923).
In this study, we evaluated on both in vitro and in vivo levels the extent of retargeting toward and therapeutic effectiveness against CEA-positive gastric cancers when using the fully human CEA antibody complex with this modified vector.
 |
Materials and Methods
|
|---|
Cell culture. We used two cancer cell lines (MKN-45 and MKN-74) derived from human gastric adenocarcinoma. A normal human hepatocyte cell line, Chang liver, was kindly provided by Dr. Niitsu (Sapporo Medical University, Sapporo, Japan). Cells were grown in RPMI 1640 supplemented with 10% fetal bovine serum. We cultured Chinese hamster ovary (CHO) cell transfectants expressing CEACAM proteins in
-MEM (Sigma, St. Louis, MO) supplemented with 10% fetal bovine serum at 37°C in 5% CO2.
pAx3-FZ33 plasmid construction. Briefly, the FZ33 vectors were generated as follows (details are available on request). The cosmid pAx357-F/RGD (also designated simply as pAx3), derived from pAdex1cw (24), was F/RGD mutant (25) with both the left side end and the right side end of the adenovirus serotype 5 genome (Fig. 1A
). The DNA fragment with the Z33 peptide motif was synthesized by PCR with the 5'-primer GAAACCGGTCTCATCAAGTTTAACATGCAGCAGCAGCGCCGCTTTTAC and the 3'-primer GTCGCTAGCATCTATGTCGTCGCGAATGCTCTTAATCTTGGCGTTGCG using the 86-base oligonucleotide ATGCAGCAGCAGCGCCGCTTTTACGAGGCCTTGCACGACCCCAACCTGAACGAGGAGCAGCGCAACGCCAAGATTAAGAGCATTCG as a template. The amino acid sequence encoded by the PCR fragment was ETGLIKFNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDDIDASD. The resultant PCR product was inserted into pSKII+hiAN encoding the adenovirus serotype 5 fiber, resulting in the plasmid pSKII+Z33. The BstXI/BamHI fragment from the pSKII+Z33 was inserted into the pWE6.7R-F/wt-2 (25), resulting in pWE6.7R-FZ33. The EcoRI/RsrII fragment from pWE6.7R-FZ33 was ligated into pAx3, resulting in pAx3-FZ33. A EcoRI/NotI (blunted) fragment from pEGFP-N1 (Clontech) was inserted into the EcoRI/BglII (blunted) sites of the pCAcc (26), resulting in pCAEGFP. The ClaI fragment from pCAEGFP was ligated into the ClaI site of pAx3-FZ33, resulting in pAx3CAEGFP-FZ33. The ß-galactosidase (ß-gal) expression cassette (CAZ3, 5,153 bp) was cut out from the pCAZ3 (25) by BamHI/BglII digestion, blunted by T4 DNA polymerase, and ligated into the SwaI site of pAx3-FZ33, resulting in pAx3CAZ3-FZ33. The Escherichia coli uracil phosphoribosyltransferase (UPRTase) gene expression cassette (27) was cut out from pCAUP by SalI/HindIII (blunted) and ligated into the SwaI site of pAx3-FZ33, resulting in pAx3CAUP-FZ33.

View larger version (17K):
[in this window]
[in a new window]
|
Fig. 1. A, schema showing the structure of pAx3. See text for details of its construction. B, outline of the structure of the Adv-FZ33 fragment containing the expression cassette. See text for details of its construction.
|
|
Generation of recombinant adenoviruses. For the generation of recombinant adenovirus, each cosmid was transfected into 293 cells by lipofection using LipofectAMINE 2000 reagent (Invitrogen). Plaques arising from the transfected 293 cells were isolated and evaluated by restriction enzyme digestion of the viral genome and sequencing of the expression units. The resultant adenoviral vectors were expanded in 293 cells and purified by cesium chloride ultracentrifugation. Purified viruses were dialyzed in PBS with 10% glycerol and stored at 80°C until use. To determine the viral concentration [viral particles (VP)/mL], the viral solution was incubated in 0.1% SDS and A260 was measured (28). Infectious titers were determined by plaque assay with 293 cells (29). Before use, contamination with replication-competent viruses in the viral stock was ruled out by PCR analysis using primers specific for E1A and E1B (30).
Antibodies and reagents. In the present study, we used the C2-45 clone (IgG4,
) as the fully human anti-CEA mAb. Preparation of the antibody has been described previously in detail (23). Mouse mAb clones F33-104 (IgG1,
), F33-60 (IgG2a,
), F82-81 (IgG2b,
), and F11-12 (IgG3,
) against human CEA (31) and mouse-human chimeric mAb ChF11-39 (IgG1; ref. 32) have been described previously. The 1B2 (IgG2a,
) was purchased from IBL (Takasaki, Japan). A mouse anti-human CAR mAb (RmcB), prepared as ascites fluid, was kindly provided by Dr. Jeffrey Bergelson (Children's Hospital of Philadelphia, Philadelphia, PA). The anti-
vß3 mAb MAB1961 and the anti-
vß5 MAB1976 were purchased from Chemicon International (Temecula, CA). Control human IgG4 was purchased from The Binding Site Ltd. (Birmingham, United Kingdom). Control mouse IgG and FITC-conjugated rabbit anti-mouse immunoglobulins were purchased from Sigma and Dako Japan (Kyoto, Japan), respectively. FITC-conjugated goat anti-human IgG (Fc) was purchased from Chemicon. CEA protein was purified from a liver metastasis derived from a colonic adenocarcinoma (33).
Flow cytometry. The reactivities of anti-CEA mAbs with various cell lines and the expression levels of CEA, CAR, and integrins were analyzed using flow cytometry. Cultured cells were harvested by incubation with trypsin-EDTA solution (0.5%; Sigma) for 5 minutes. Detached cells were centrifuged and resuspended in PBS containing 2% bovine serum albumin at a concentration of 105/mL. The cells were first incubated with 10 µg/mL antibody for 1 hour on ice. Subsequently, the cells were washed and incubated with FITC-conjugated rabbit anti-mouse immunoglobulins for 30 minutes on ice and in the dark. After washing in 2% bovine serum albumin/PBS, the cells were resuspended in 500 µL of 2% bovine serum albumin/PBS. Analysis was done on a FACSCalibur (Becton Dickinson, San Jose, CA).
Transduction efficiency in vitro. EGFP gene transduction was carried out by first plating cells in six-well plates at 2 x 105 per well 1 day before adenoviral vector infection. Cells were treated with serum-free medium containing of 3 µg/mL antibody (C2-45 or control isotype IgG) or without antibody at 37°C in 5% CO2 for 1 hour. After incubation, the cells were washed with serum-free medium and then cultured in 1,000 µL serum-free medium containing Ax3CAEGFP-FZ33 (0-1,000 VP/cell) at 37°C in 5% CO2 for 1 hour. After incubation, cells were washed twice with serum-free medium and then cultured in medium with 10% fetal bovine serum for 24 hours. Unincorporated free antibody molecules would act as competitors of Adv-FZ33-mediated gene delivery to CEA-expressing cells. To exclude the free antibodies, we rinsed the target cells after the antibody treatment. Thereafter, we added the viral vector in in vitro gene transfer assay. The transduction efficiency was screened for CEA-positive or CEA-negative cell lines. Green fluorescent protein (GFP) activity was measured by fluorescence-activated cell sorting analysis.
Transgene expression in vitro. The LacZ gene transduction was done according to the procedures of in vitro gene transfer assay. Cells were plated into 96-well plates at a density of 1 x 104 per well. Cells were treated with antibody (C2-45 or control isotype IgG) or without antibody and then infected with Ax3CAZ3-FZ33 at 100, 300, and 1,000 VP. Infected cells were cultured for 24 hours. Transgene expression was compared by infecting CEA-positive and CEA-negative cell lines. LacZ activity was measured by a ß-gal reporter gene assay (Roche Molecular Biochemicals, Indianapolis, IN).
Competition assay. The specificity of targeting of the anti-CEA mAb was evaluated in CEA-CHO cells cultured in medium containing C2-45 and different concentrations of purified CEA. CEA-CHO cells were plated in 96-well plates at 1 x 104 per well. Cells were incubated in medium with purified CEA protein (0-104 ng/mL) and 3 µg/mL antibody (C2-45 or control human IgG4) for 1 hour. Thereafter, cells were infected with Ax3CAZ3-FZ33 at 1,000 VP for 1 hour. Transgene expression was measured by a ß-gal reporter gene assay after 24 hours.
5-Fluorouracil sensitivity in vitro. E. coli UPRT gene transduction was done according to the procedures of in vitro gene transfer assay. Cells were plated into 24-well plates at 5 x 104 per well. These cells were treated with antibody (C2-45 or control human IgG4) or without antibody and infected with Ax3CAUP-FZ33 (UP-FZ33) at 100 VP for 1 hour. Infected cells were cultured in medium containing 5-fluorouracil (5-FU; 0-100 µmol/L) for 4 days. The relative sensitivities to 5-FU were compared by infecting CEA-positive and CEA-negative cell lines. Cell survival was evaluated by a 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay.
LacZ expression in vivo mediated by Adv-FZ33 premixed with anti-CEA antibody. Female athymic nude mice (BALB/c nu/nu) were obtained from Japan Charles River (Yokohama, Japan) and used to evaluate the ability and selectivity of Adv-FZ33 premixed with anti-CEA mAb to mediate gene transduction in disseminated gastric cancer in vivo. The mice were 4 weeks old at the beginning of each experiment. Freshly harvested MKN-45 (1 x 107 cells) that had been resuspended in PBS was injected into the peritoneal cavity. The Ax3CAZ3-FZ33 incubated with either 3 µg/mL C2-45 or IgG4 in serum-free medium. Vector-antibody premixture or vector alone was injected i.p. (5 x 109 VP/animal) into the mice 10 days after they received the MKN-45. Four days after vector administration, the mice were sacrificed and tissues were fixed by systemic perfusion with 4% paraformaldehyde for 15 minutes. To detect expression of ß-gal, the peritoneal cavities were stained with X-gal solution [Sigma; 1 mg/mL X-gal in PBS (pH 7.2), 2 mmol/L MgCl2, 4 mmol/L potassium ferricyanide] for 4 hours.
Gene therapy using Adv-FZ33 premixed with anti-CEA mAb in mice with disseminated peritoneal gastric cancer. Female mice (BALB/c nu/nu) were injected i.p. with MKN-45 (1 x 107 cells per mouse) in PBS (300 µL) to evaluate the ability of Adv-FZ33 premixed with anti-CEA mAb to mediate tumor-specific gene therapy against established tumors in vivo. The mice were then randomly assigned into five groups that received the following treatments: (a) UP-FZ33 containing 30 µg/mL C2-45 followed by 10 mg/kg 5-FU treatment, (b) UP-FZ33 containing 30 µg/mL control IgG4 followed by 10 mg/kg 5-FU treatment, (c) UP-FZ33 without antibody followed by 10 mg/kg 5-FU treatment, (d) PBS followed by 10 mg/kg 5-FU treatment, and (e) no treatment (PBS only). Four days after the MKN-45 injections, adenoviral vectors (5 x 109 VP) in a total volume of 300 µL were injected into the peritoneal cavity of the mice. Starting on the following day, 5-FU or PBS was given i.p. daily for 5 days. This treatment schedule was then repeated. Animals were sacrificed at 17 days after tumor inoculation and the disseminated peritoneal mass was collected and weighed from each animal (n = 3 in each group). To determine whether therapeutic reductions in tumor burden were also reflected by prolongation of the survival of the animals, an additional set of animals was inoculated and treated with the same protocols as above (n = 6 in each group) and survival times were evaluated. All of the animal experiments were done under the guidelines established by Sapporo Medical University.
Statistical evaluation. Statistical values are presented as mean ± SD. The significance of differences between groups was assessed by a Student's t test. Statistical significance was defined as P < 0.05. Survival was analyzed by the Kaplan-Meier method and differences were analyzed by a log-rank test.
 |
Results
|
|---|
Construction of Adv-FZ33. The schema for construction of Adv-FZ33 is shown in Fig. 1B. A synthetic 33amino acid IgG-binding domain (Z33), derived from staphylococcal protein A, was inserted into the HI loop of the knob protein. This modified fiber retained the ability to assemble into trimers, bound IgG with high affinity, and was incorporated into viral particles. Adv-FZ33 binds immunoglobulins and allows an antibody to redirect the vector to a new target molecule on the cell surface. Our Adv-FZ33 had intact CAR-binding structure (34) and retained CAR-binding ability (data not shown), which was in accord with the report by Volpers et al.
Particle numbers (VP/mL) to infectious titers (plaque-forming units/mL) ratios (VP/plaque-forming units) for the Adv-FZ33 used in those experiments were 35.6 (Ax3CAZ3-FZ33), 65.6 (Ax3CAEGFP-FZ33), and 22.8 (Ax3CAUP-FZ33).
Specificity of anti-CEA mAb-mediated targeting. Firstly, we determined the specificity of the C2-45 antibody for CEA by flow cytometric analysis. We confirmed that C2-45 bound only to CEA-CHO (encoding CEACAM5 gene) cells and not to CEACAM8-CHO cells (Fig. 2A
). Next, we determined whether Adv-FZ33 could infect CEA-expressing cells via an anti-CEA mAb. As shown in Fig. 2B, Adv-FZ33 alone or with a control mAb showed poor transduction of CEA-CHO cells. However, Adv-FZ33 with C2-45 showed a strongly enhanced rate of transduction. In contrast, no significant effect on transduction efficiency was observed when CEACAM8-CHO cells were exposed to Ax3CAEGFP-FZ33 with or without the antibody. We used Ax3CAZ3-FZ33 to carry out a competitive inhibition assay to confirm that the anti-CEA mAb-mediated transduction of CEA-CHO cells was the result of specific binding of the mAb to the vector and occurred via a CAR-independent cell entry pathway. In this experiment, the vector was pretreated with either C2-45 (100 ng) or control IgG4 (100 ng) before transduction of CEA-CHO cells in the presence of CEA protein (0-104 ng/mL). As shown in Fig. 2C, the high level concentration of CEA protein reduced ß-gal activity in cells transduced by vector pretreated with C2-45 but not in cells transduced with vector pretreated with the control antibody. In the presence of 104 ng/mL CEA protein, ß-gal activity was decreased to 41% following infection of vector pretreated with C2-45 compared with control (no addition of CEA protein). However, the absolute value of ß-gal activity was
10 times higher in cells transduced by the C2-45-treated vector than in cells exposed to the vector pretreated with the control antibody.

View larger version (19K):
[in this window]
[in a new window]
|
Fig. 2. Specificity of anti-CEA mAb-mediated targeting. A, analysis of the expression of CEA on CEACAM-transfected CHO cells by flow cytometry. Open histograms, staining with an isotype control antibody; shaded histograms, staining with C2-45. B, transduction efficiency of CEACAM-transfected CHO cells evaluated by flow cytometry. Cells were infected with Ax3CAEGFP-FZ33 at 1,000 VP/cell after incubation with C2-45 or isotype control antibodies (3 µg/mL). Open histograms, staining with an isotype control antibody; shaded histograms, staining with C2-45. Numbers, percentages of GFP-positive cells. C, competitive inhibition assay. CEA-CHO cells were transduced with Ax3CAZ3-FZ33 at 1,000 VP/cell after preincubation with C2-45 ( ) or isotype control antibodies ( ; 1 µg/mL) in the presence of purified CEA protein. Points, mean; bars, SD. RLU, relative light units.
|
|
We also screened other mAbs against human CEA to determine whether they could enhance the transduction efficiency of CEA-positive cells by Adv-FZ33 (Table 1
). Although transduction efficiency was increased when Adv-FZ33 was bound to various mouse anti-CEA mAbs, none showed the same enhancement of gene expression in CEA-positive cells as C2-45.
Expression of CAR and integrins in CEA-positive and CEA-negative cell lines. We screened two cancer cell lines, MKN-45 and MKN-74, and Chang liver with antibodies against various cell surface markers (Fig. 3A
). The CEA-positive cell line MKN-45, but not the CEA-negative MKN-74 cell line or Chang liver cells, showed a strong reaction with C2-45. All three cell lines showed evident expression of the primary adenovirus receptor, CAR, and the secondary adenovirus receptors, integrins
vß3 and
vß5. These observations indicate that CAR or integrin expression in human cell lines cannot be used as specific targets in cancer gene therapy.


View larger version (34K):
[in this window]
[in a new window]
|
Fig. 3. Improvement of gene transduction in CEA-positive gastric cancer cells in vitro. A, expression of human CAR, integrins, and CEA in MKN-45, MKN-74, and Chang-liver cells. Open histograms, staining with an isotype control antibody; shaded histograms, staining with C2-45, anti-CAR, anti- vß3, and vß5, respectively. B, transduction efficiency in Ax3CAEGFP-FZ33-infected human cells was evaluated by flow cytometry. Cells were infected with Ax3CAEGFP-FZ33 at 0 to 1,000 VP/cell after incubation with C2-45 or control IgG4. Open histograms, isotype control antibody without Adv-FZ33; shaded histograms, EGFP gene expression by Adv-FZ33 with C2-45 or control IgG4. Numbers, percentages of GFP-positive cells. C, ß-gal activity in cells targeted with modified adenoviral vector targeted at CEA. Cells were infected with Ax3CAZ3-FZ33 at 0 to 1,000 VP/cell after incubation with C2-45 ( ) or isotype control antibodies ( ) or without antibody ( ). ß-gal activity was significantly increased in CEA-expressing cells infected by combination of vector-anti-CEA antibody compared with control. Points, mean (n = 3); bars, SD *, P < 0.05, Student's t test.
|
|
Improvement of transduction efficiency of CEA-positive cells in vitro. As shown in Fig. 3B, MKN-74 and Chang liver gave the same levels of gene transfer following application of either Ax3CAEGFP-FZ33 pretreated with C2-45 or control antibody. In contrast, gene transfer efficiency was significantly increased in the MKN-45 using vector treated with C2-45 compared with the control antibody. MKN-45 infected with 10 VP/cell showed a 7.82-fold enhancement in gene transfer. At a concentration of 1,000 VP/cell, C2-45-mediated adenoviral infection induced 92.29% transduction.
Improvement of transgene expression in CEA-positive cells in vitro. We next sought to determine whether transgene expression was increased in a similar fashion to transduction efficiency using the modified adenovirus (Fig. 3C). In Chang liver and MKN-74, application of Ax3CAZ3-FZ33 that had been pretreated with C2-45 gave transgene expression equal to that for the adenovirus treated with the control antibody or adenovirus alone. In contrast, ß-gal activity in MKN-45 infected with Ax3CAZ3-FZ33 pretreated with C2-45 was significantly increased compared with cells infected with the combination of adenovirus-control antibody or adenovirus alone. In MKN-45, C2-45-mediated vector infection at a 100, 300, or 1,000 VP/cell showed 4.5-, 9.4-, or 21.8-fold enhancement, respectively, in ß-gal activity compared with vector alone.
UPRT gene transduction sensitizes CEA-positive cells to 5-FU in vitro. E. coli UPRT is a pyrimidine salvage enzyme that catalyzes the synthesis of UMP, a precursor of the pyrimidine nucleotide, from uracil and phosphoribosylpyrophosphate. The sensitivity of human CEA-positive or CEA-negative gastric cancer cell lines to 5-FU was evaluated using UP-FZ33. Transduction of the UPRT gene restores drug sensitivity to cancer cells that show resistance to 5-FU (32). As shown in Fig. 4
, when the cells were infected with UP-FZ33 alone, the IC50 of 5-FU decreased from 24 to 15 µmol/L for MKN-74 and from 1.8 to 0.22 µmol/L for Chang liver cells. With respect to MKN-45, IC50 did not change as 3.1 µmol/L. When antibody-pretreated cells were infected with UP-FZ33, 5-FU sensitivity of IgG4-treated cells increased compared with C2-45, although there was no significant difference in the IC50 with respect to MKN-74. For Chang liver, there was no difference in sensitivity between cells treated with vector alone or with vector treated with either C2-45 or the control antibody. In terms of the MKN-45, UP-FZ33 with C2-45 significantly increased the sensitivity of these cells to 5-FU, with a 10.5-fold difference in IC50 (0.081 µmol/L with C2-45 versus 0.85 µmol/L with the IgG4 antibody).
As shown in Table 2
, it is to be noted that UP-FZ33 with a control IgG4 gave significant (3.6- to 3.3-fold) increase in 5-FU sensitivity in MKN-45 or MKN-74, respectively, compared with the vector alone. The mechanism underlying this increase is not clear. This effect was observed only when Adv-FZ33 and antibody were simultaneously applied to the target cell.
View this table:
[in this window]
[in a new window]
|
Table 2. Sensitivities of CEA-positive and CEA-negative cell lines to 5-FU following infection with different combinations of Ax3CAUP-FZ33 and antibodies
|
|
Ax3CAZ3-FZ33 premixed with C2-45 enhances selective gene transfer in CEA-positive cells in vivo. To evaluate selective gene transfer in vivo, mice with disseminated peritoneal tumors were given an i.p. injection of Ax3CAZ3-FZ33 with or without antibody. In in vivo gene transfer assay, we first mixed adenoviruses with antibodies and then injected into mice. This method seems to be more practical in terms of future clinical application. The peritoneal cavity of a mouse that received Ax3CAZ3-FZ33 with C2-45 showed selectively enhanced expression of ß-gal in disseminated tumors (Fig. 5A
). In contrast, a mouse receiving Ax3CAZ3-FZ33 with the control IgG4 showed little expression of ß-gal. X-gal-positive staining was present only in cancer cells not in other organs, including liver, spleen, and kidney. These observations show that Ax3CAZ3-FZ33 with C2-45 is able to selectively augment expression of a transgene in CEA-positive gastric cancer cells in vivo. Analyses of tissue sections showed that the LacZ gene expression was limited to superficial layers of the peritoneal tumors (Fig. 5B).

View larger version (84K):
[in this window]
[in a new window]
|
Fig. 5. Distribution of the LacZ gene expression after i.p. injection of Adv-FZ33-anti-CEA antibody mixture in mice with disseminated abdominal cancer. Ten days after MKN-45 inoculation, mice were given an i.p. injection (5 x 109 VP) of Ax3CAZ3-FZ33 premixed with either C2-45 or isotype control antibodies. Four days later, the mice were sacrificed and X-gal staining was done. A, macroscopic appearance of peritoneal cavity after injection of Ax3CAZ3-FZ33 alone (left), Ax3CAZ3-FZ33/IgG4 (middle), and Ax3CAZ3-FZ33/C2-45 (right). Mice that received Ax3CAZ3-FZ33 or Ax3CAZ3-FZ33/IgG4 showed faint staining of the main tumor (arrowhead) and metastatic nodules (arrow). Mice that received Ax3CAZ3-FZ33/C2-45 showed clear staining of both the main tumor and metastatic nodules. In all groups, normal organs were not stained by X-gal. B, sections through the main tumors of mice that received Ax3CAZ3-FZ33 alone (left), Ax3CAZ3-FZ33/IgG4 (middle), or Ax3CAZ3-FZ33/C2-45 (right). LacZ expression is confined to the superficial layers of the tumor. Magnification, x40.
|
|
Therapeutic effect of Ax3CAUP-FZ33 premixed with anti-CEA mAb plus 5-FU in vivo. The macroscopic appearances of the abdominal cavities of treated mice is shown in Fig. 6A
. A very large main tumor below the stomach and large multiple disseminated tumors were observed on the mesentery in the PBS-only group (total weight, 1.14 ± 0.02 g) and the 5-FU-only group (total weight, 0.99 ± 0.23 g). A very large main tumor and middle-sized multiple disseminated tumors were observed in the UP-FZ33/IgG4/5-FU group (total weight, 0.52 ± 0.19 g) and the UP-FZ33/5-FU group (total weight, 0.57 ± 0.10 g). On the other hand, tumor growth in mice treated with UP-FZ33/C2-45/5-FU was significantly suppressed, and tumor volumes were less than one-fourth of those of the control IgG4 group (total weight, 0.12 ± 0.11 g; P < 0.05). The mean numbers of disseminated foci were 66.7 ± 6.5 in the PBS-only group, 40.7 ± 6.4 in the 5-FU-only group, 27.7 ± 8.1 in the UP-FZ33/5-FU group, 25.7 ± 8.9 in the UP-FZ33/IgG4/5-FU group, and 10.7 ± 9.2 in the UP-FZ33/C2-45/5-FU group (Fig. 6B). However, the difference between the latter two groups was not statistically significant. Serum CEA levels were also measured to enable comparisons of the treatments in tumor-bearing mice. We found that serum CEA levels decreased in a fashion that correlated with reduction of tumor burden (data not shown).

View larger version (39K):
[in this window]
[in a new window]
|
Fig. 6. Therapeutic effects of treating mice with disseminated abdominal cancer with a combination of Ax3CAUP-FZ33 mixed with anti-CEA mAb and 5-FU. Four days after MKN-45 inoculation, mice were given an i.p. injection of PBS or antibody-Ax3CAUP-FZ33 premixture on days 4 and 10 followed by an i.p. injection of 5-FU on days 5 to 9 and 11 to 15. The animals were sacrificed for analysis on day 17. A, macroscopic appearance of disseminated peritoneal cancer in mice of each treatment group. Arrowhead, main tumor; arrow, metastatic nodules. B, mean body weights (left), tumor weights (middle), and tumor numbers (right) were assessed in each of the five treatment groups and in normal mice. In mice treated with UP-FZ33/C2-45/5-FU, the growth of tumors was significantly suppressed compared with the control IgG4 group. Columns, mean (n = 3); bars, SD. P < 0.05. C, survival curves for mice with disseminated peritoneal tumors treated with a CEA-targeted gene delivery strategy. Survival was analyzed by the Kaplan-Meier method and differences were analyzed by a log-rank test.
|
|
Finally, we examined the survival effects of UP-FZ33 premixed with anti-CEA mAb plus 5-FU in mice with peritoneal disseminated gastric cancer. Severe cancer cachexia appeared
10 days after injection in mice given only PBS or 5-FU treatment. Mice in these groups started to die from day 16 with the last mouse dying on day 34. In contrast, cancer cachexia only appeared in mice treated with UP-FZ33/C2-45/5-FU 25 to 35 days after injection. One of these mice died on day 28 after injection, a period clearly longer than the average survival time of control mice given only PBS or 5-FU. Mice that received UP-FZ33 with or without control IgG4 died between days 24 and 51. The median survival times of various treatment groups were 22 days (PBS only), 23 days (5-FU only), 35 days (UP-FZ33/5-FU), 32 days (UP-FZ33/IgG4/5-FU), and 42 days (UP-FZ33/C2-45/5-FU; Fig. 6C). The median survival time of the UP-FZ33/C2-45/5-FU group was significantly longer than those of the PBS-only and 5-FU-only treatment groups (P < 0.01 versus PBS and 5-FU groups). On the other hand, no significant difference was present between the UP-FZ33/5-FU or UP-FZ33/IgG4/5-FU groups and the PBS-only or 5-FU-only treatment groups. When we used the >25% body weight loss as survival end point, the survival curve showed essentially the same significance as the Fig. 6D (data not shown).
 |
Discussion
|
|---|
In this study, we found that the strategy of Adv-FZ33 with an anti-CEA mAb can result in improved the effectiveness, both in vitro and in vivo, of antitumor treatments of gastric cancer cells expressing CEA.
We have shown that Adv-FZ33 with C2-45 enhanced transduction efficiency and gene delivery in CEA-expressing CHO cells. As the CHO cells do not express CAR, the infection by Adv-FZ33 with C2-45 must have been via a CAR-independent pathway. CEA is a glycophosphatidylinositol anchor-type protein that is linked to the cell surface (35, 36). If an antibody binds to a glycophosphatidylinositol-type antigen, it is not necessarily the case that the signal will be internalized by the cell. Therefore, the infection pathway of Adv-FZ33 with C2-45 will involve an initial attachment to the cell surface CEA (instead of CAR) followed by internalization through interaction of the penton base of the viral capsid with
ß class integrins. Indeed, CHO cells have high expression of
vß5 integrin. Next, we evaluated gene delivery to human gastric cancer cell lines that highly express CAR and showed that Adv-FZ33 with C2-45 enhanced gene transduction through binding to the CEA on target cells compared with the only CAR-dependent pathway. Thus, CEA seems to be an attractive target molecule for the attachment of adenovirus vectors in gastric cancer gene therapy. The levels of
vß3 or
vß5 detected on the MKN-45 were rather low. Whereas
vß3 and
vß5 integrins act as key molecule for cellular internalization of adenovirus, other integrin heterodimers, such as
2ß1 or
3ß1 (3739), might play an important role for adenovirus internalization in the MKN-45.
We also examined whether other mouse mAbs against human CEA would likewise enhance transduction efficiency when combined with Adv-FZ33. Although these antibodies had comparatively high reactivity for the antigen, gene expression was weak compared with C2-45. Clearly, choice of antibody will be an important determinant for successful application of this strategy.
We showed that MKN-45 in vitro showed dramatically enhanced sensitivity to 5-FU in the presence of Adv-FZ33 with an anti-CEA antibody-mediated UPRT gene. MKN-45 infected with LacZ-FZ33 with C2-45 showed a 5-fold enhancement in ß-gal activity, whereas the same amount of UP-FZ33 with C2-45 increased 5-FU sensitivity much more remarkably (i.e., 10-fold). One possible explanation for this observation is the "bystander effect" that can occur where there is cellular contact between infected and uninfected cells (27).
Two issues need to be considered with regard to targeting of cancer cells in vivo using Adv-FZ33-anti-CEA mAb combination: (a) the stability of antibody-adenovirus vector complexes and (b) whether circulating CEA derived from tumor cells could inhibit a vector-antibody complex. With respect to the first point, as far as use of cancer gene therapy in a clinical setting is concerned, it is important that the antibody-adenovirus vector complexes are stable in an environment containing circulating immunoglobulins (
10 mg/mL). Henning et al. reported that antibody-mediated gene transfer was completely abolished when adenovirus vector-herceptin complexes were incubated with 50% whole normal mouse or human serum (4042). It is expected that antibody-Adv-FZ33 complexes might be unstable when they were given systemically into the blood. Therefore, covalent cross-linking of adenovirus with antibody would enhance the stability of the conjugate, leading to the more effective gene transduction to the target cells. However, in our experimental model, administration of a combination of Adv-FZ33 with anti-CEA mAb was able to augment expression of the transgene selectively in CEA-positive gastric cancer cells in vivo. The vector-antibody combination may be able to target cancer cells in the peritoneal cavity for three reasons: (a) the concentration of immunoglobulins in the peritoneal cavity is lower than found in serum, (b) vector-mAb complexes could come directly into contact with the tumor cells because MKN-45 do not produce ascites in the disseminated peritoneal model, and (c) the peritoneal cavity is a closed space in which viral infection is comparatively easy despite the presence of physiologic ascites. With regard to the second point, free CEA derived from MKN-45 did not inhibit the vector-anti-CEA mAb conjugation in the abdominal cavity. In vitro, at high levels of CEA protein (10,000 ng/mL), the expression level of the reporter gene was >10 times higher with C2-45 than that obtained with the control antibody. Our observations are consistent with those of Nolan et al. who described an immunization strategy involving direct genetic alteration of T cells to create chimeric immunoglobulin T-cell receptors. These receptors can bind to CEA through anti-CEA single-chain Fv (43). In their study, incubation in the presence of soluble CEA at 10,000 ng/mL did not interfere with complex formation. In cancer patients, serum CEA levels may reach 1,000 ng/mL compared with the normal level of <5 ng/mL. In our experimental model of disseminated abdominal cancer, the maximum value of CEA concentration in the blood was 200 ng/mL in the untreated group (data not shown).
Furthermore, we showed that the survival rate of mice given UP-FZ33/C2-45/5-FU was significantly higher than those that received either PBS or 5-FU only. However, injection of vector-anti-CEA mAb complexes could not abrogate tumor development completely. By staining the peritoneal cavity with X-gal, we found that the transgene was expressed in surface cell layers of the peritoneal tumors. It seems that it will be difficult to deliver a transgene into deeper layers of the tumors using i.p. injection of adenoviral vectors. To determine if an earlier application of the vectors could overcome this problem, we began treatment 4 days after i.p. injection of MKN-45 when the tumors were only macroscopic nodules. We found that tumor volumes in mice treated with UP-FZ33/C2-45/5-FU were significantly smaller than those in the control IgG4 group on day 17 after tumor cell inoculation. However, the number of surviving mice treated with UP-FZ33/C2-45/5-FU decreased rapidly from day 30 after implantation. Use of a replication-competent adenovirus or a killer gene with a potent bystander effect, such as thymidine kinase, may improve treatment outcomes. However, our UP-FZ33/C2-45/5-FU treatment exerted a powerful antitumor effect compared with previous investigations using adenoviral vectors. Lan et al., for example, studied an adenoviral vector carrying the CEA promoter to direct cytosine deaminase (AdCEA-CD) transgene expression and investigated its therapeutic value in mice with disseminated peritoneal tumors, the latter the result of i.p injection of MKN-45 (44). AdCEA-CD required 14 x 109 plaque-forming units (approximately equivalent to 70 x 1010 VP) to obtain a statistical significant difference between groups treated with AdCEA-CD/5-fluorocytosine compared with 5-fluorocytosine only. In our animal experiments, statistical significance difference between the UP-FZ33/C2-45/5-FU and 5-FU groups was obtained only by UP-FZ33 infection with 10 x 109 VP. Therefore, our use of C2-45-binding Adv-FZ33 can result in effective targeting of CEA-positive cells.
Recently, several investigators have described other targeting strategies using adenovirus vectors (4549). However, these approaches are time consuming and it is costly to construct recombinant vectors against candidate target molecules for each individual case. However, Adv-FZ33 can infect target cells without reconstruction of the vector simply by changing the antibody against specific targets.
In summary, CEA-specific gene delivery to CEA-positive cells mediated by Adv-FZ33 through anti-CEA antibody significantly enhanced transduction efficiency and gene expression. I.p. injection with the vector-antibody complexes significantly suppressed tumor growth in a mouse model of disseminated abdominal cancer. This novel strategy may be a promising tool for cancer gene therapy.
 |
Acknowledgments
|
|---|
We thank Tomoko Sonoda for statistical support.
 |
Footnotes
|
|---|
Grant support: Ministry of Education, Science, Sports, and Culture, Japan grant-in-aid 17591421 (T. Tanaka) and grant 17016059 (H. Hamada).
The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
Received 1/ 6/06;
revised 3/13/06;
accepted 3/20/06.
 |
References
|
|---|
- Parkin DM. Global cancer statistics in the year 2000. Lancet Oncol 2001;2:53343.[CrossRef][Medline]
- Jemal A, Thomas A, Murray T, Thun M. Cancer statistics, 2002. CA Cancer J Clin 2002;52:2347.[Abstract/Free Full Text]
- Brody SL, Crystal RG. Adenovirus-mediated in vivo gene transfer. Ann N Y Acad Sci 1994;716:90101; discussion 1013.[Abstract]
- Bergelson JM, Cunningham JA, Droguett G, et al. Isolation of a common receptor for coxsackie B viruses and adenoviruses 2 and 5. Science 1997;275:13203.[Abstract/Free Full Text]
- Tomko RP, Xu R, Philipson L. HCAR and MCAR: the human and mouse cellular receptors for subgroup C adenoviruses and group B coxsackieviruses. Proc Natl Acad Sci U S A 1997;94:33526.[Abstract/Free Full Text]
- Hong SS, Karayan L, Tournier J, Curiel DT, Boulanger PA. Adenovirus type 5 fiber knob binds to MHC class I
2 domain at the surface of human epithelial and B lymphoblastoid cells. EMBO J 1997;16:2294306.[CrossRef][Medline] - Wickham TJ, Mathias P, Cheresh DA, Nemerow GR. Integrins
vß3 and
vß5 promote adenovirus internalization but not virus attachment. Cell 1993;73:30919.[CrossRef][Medline] - Harris JD, Lemoine NR. Strategies for targeted gene therapy. Trends Genet 1996;12:4005.[CrossRef][Medline]
- Volpers C, Thirion C, Biermann V, et al. Antibody-mediated targeting of an adenovirus vector modified to contain a synthetic immunoglobulin G-binding domain in the capsid. J Virol 2003;77:2093104.[Abstract/Free Full Text]
- Korokhov N, Mikheeva G, Krendelshchikov A, et al. Targeting of adenovirus via genetic modification of the viral capsid combined with a protein bridge. J Virol 2003;77:1293140.[Abstract/Free Full Text]
- Paxton RJ, Mooser G, Pande H, Lee TD, Shively JE. Sequence analysis of carcinoembryonic antigen: identification of glycosylation sites and homology with the immunoglobulin supergene family. Proc Natl Acad Sci U S A 1987;84:9204.[Abstract/Free Full Text]
- Fichera A, Michelassi F, Arenas RB. Selective expression of carcinoembryonic antigen promoter in cancer cell lines: targeting strategy for gene therapy in colorectal cancer. Dis Colon Rectum 1998;41:74754.[CrossRef][Medline]
- Hammarstrom S. The carcinoembryonic antigen (CEA) family: structures, suggested functions and expression in normal and malignant tissues. Semin Cancer Biol 1999;9:6781.[CrossRef][Medline]
- Benchimol S, Fuks A, Jothy S, Beauchemin N, Shirota K, Stanners CP. Carcinoembryonic antigen, a human tumor marker, functions as an intercellular adhesion molecule. Cell 1989;57:32734.[CrossRef][Medline]
- Khare PD, Shao-Xi L, Kuroki M, et al. Specifically targeted killing of carcinoembryonic antigen (CEA)-expressing cells by a retroviral vector displaying single-chain variable fragmented antibody to CEA and carrying the gene for inducible nitric oxide synthase. Cancer Res 2001;61:3705.[Abstract/Free Full Text]
- Ikeda S, Kuroki M, Haruno M, et al. Epitope mapping of the carcinoembryonic antigen with various related recombinant proteins expressed in Chinese hamster ovary cells and 25 distinct monoclonal antibodies. Mol Immunol 1992;29:22940.[Medline]
- Johnson DA, Barton RL, Fix DV, Scott WL, Gutowski MC. Induction of immunogenicity of monoclonal antibodies by conjugation with drugs. Cancer Res 1991;51:57746.[Abstract/Free Full Text]
- Beauchemin N, Draber P, Dveksler G, et al. Redefined nomenclature for members of the carcinoembryonic antigen family. Exp Cell Res 1999;252:2439.[CrossRef][Medline]
- Kuroki M, Abe H, Imakiirei T, et al. Identification and comparison of residues critical for cell-adhesion activities of two neutrophil CD66 antigens, CEACAM6 and CEACAM8. J Leukoc Biol 2001;70:54350.[Abstract/Free Full Text]
- Bjerner J, Lebedin Y, Bellanger L, et al. Protein epitopes in carcinoembryonic antigen. Report of the ISOBM TD8 workshop. Tumour Biol 2002;23:24962.[CrossRef][Medline]
- Murakami M, Kuroki M, Arakawa F, et al. A reference of the GOLD classification of monoclonal antibodies against carcinoembryonic antigen to the domain structure of the carcinoembryonic antigen molecule. Hybridoma 1995;14:1928.[Medline]
- Hammarstrom S, Shively JE, Paxton RJ, et al. Antigenic sites in carcinoembryonic antigen. Cancer Res 1989;49:48528.[Abstract/Free Full Text]
- Imakiire T, Kuroki M, Shibaguchi H, et al. Generation, immunologic characterization and antitumor effects of human monoclonal antibodies for carcinoembryonic antigen. Int J Cancer 2004;108:56470.[CrossRef][Medline]
- Miyake S, Makimura M, Kanegae Y, et al. Efficient generation of recombinant adenoviruses using adenovirus DNA-terminal protein complex and a cosmid bearing the full-length virus genome. Proc Natl Acad Sci U S A 1996;93:13204.[Abstract/Free Full Text]
- Nakamura T, Sato K, Hamada H. Effective gene transfer to human melanomas via integrin-targeted adenoviral vectors. Hum Gene Ther 2002;13:61326.[CrossRef][Medline]
- Yoshida Y, Hamada H. Adenovirus-mediated inducible gene expression through tetracycline-controllable transactivator with nuclear localization signal. Biochem Biophys Res Commun 1997;230:42630.[CrossRef][Medline]
- Kanai F, Kawakami T, Hamada H, et al. Adenovirus-mediated transduction of Escherichia coli uracil phosphoribosyltransferase gene sensitizes cancer cells to low concentrations of 5-fluorouracil. Cancer Res 1998;58:194651.[Abstract/Free Full Text]
- Nyberg-Hoffman C, Shabram P, Li W, Giroux D, Aguilar-Cordova E. Sensitivity and reproducibility in adenoviral infectious titer determination. Nat Med 1997;3:80811.[CrossRef][Medline]
- Kanegae Y, Lee G, Sato Y, et al. Efficient gene activation in mammalian cells by using recombinant adenovirus expressing site-specific Cre recombinase. Nucleic Acids Res 1995;23:381621.[Abstract/Free Full Text]
- Zhang WW, Koch PE, Roth JA. Detection of wild-type contamination in a recombinant adenoviral preparation by PCR. Biotechniques 1995;18:4447.[Medline]
- Kuroki M, Arakawa F, Haruno M, et al. Biochemical characterization of 25 distinct carcinoembryonic antigen (CEA) epitopes recognized by 57 monoclonal antibodies and categorized into seven groups in terms of domain structure of the CEA molecule. Hybridoma 1992;11:391407.[Medline]
- Haruno M, Kuroki M, Matsunaga K, et al. Tumor-specific accumulation of 125I-labeled mouse-human chimeric anti-CEA antibody in a xenografted human cancer model demonstrated by whole-body autoradiography and immunostaining. Nucl Med Biol 1996;23:8216.[Medline]
- Matsuoka Y, Matsuo Y, Okamoto N, Kuroki M, Kuroki M, Ikehara Y. Highly effective extraction of carcinoembryonic antigen with phosphatidylinositol-specific phospholipase C. Tumour Biol 1991;12:918.[Medline]
- Roelvink PW, Milee G, Einfeld DA, Kovesdi I, Wickham TJ. Identification of a conserved receptor-binding site on the fiber proteins of CAR-recognizing adenoviridae. Science 1999;286:156871.[Abstract/Free Full Text]
- Hefta SA, Hefta LJ, Lee TD, Paxton RJ, Shively JE. Carcinoembryonic antigen is anchored to membranes by covalent attachment to a glycosylphosphatidylinositol moiety: identification of the ethanolamine linkage site. Proc Natl Acad Sci U S A 1988;85:464852.[Abstract/Free Full Text]
- Takami N, Misumi Y, Kuroki M, Matsuoka Y, Ikehara Y. Evidence for carboxyl-terminal processing and glycolipid-anchoring of human carcinoembryonic antigen. J Biol Chem 1988;263:1271620.[Abstract/Free Full Text]
- Ruoslahti E. RGD and other recognition sequences for integrins. Annu Rev Cell Dev Biol 1996;12:697715.[CrossRef][Medline]
- Hynes RO, Schwarzbauer JE, Tamkun JW. Isolation and analysis of cDNA and genomic clones of fibronectin and its receptor. Methods Enzymol 1987;144:44763.[Medline]
- Dehari H, Ito Y, Nakamura T, et al. Enhanced antitumor effect of RGD fiber-modified adenovirus for gene therapy of oral cancer. Cancer Gene Ther 2003;10:7585.[CrossRef][Medline]
- Henning P, Magnusson MK, Gunneriusson E, et al. Genetic modification of adenovirus 5 tropism by a novel class of ligands based on a three-helix bundle scaffold derived from staphylococcal protein A. Hum Gene Ther 2002;13:142739.[CrossRef][Medline]
- Magnusson MK, Hong SS, Henning P, Boulanger P, Lindholm L. Genetic retargeting of adenovirus vectors: functionality of targeting ligands and their influence on virus viability. J Gene Med 2002;4:35670.[CrossRef][Medline]
- Henning P, Andersson KM, Frykholm K, et al. Tumor cell targeted gene delivery by adenovirus 5 vectors carrying knobless fibers with antibody-binding domains. Gene Ther 2005;12:21124.[CrossRef][Medline]
- Nolan KF, Yun CO, Akamatsu Y, et al. Bypassing immunization: optimized design of "designer T cells" against carcinoembryonic antigen (CEA)-expressing tumors, and lack of suppression by soluble CEA. Clin Cancer Res 1999;5:392841.[Abstract/Free Full Text]
- Lan KH, Kanai F, Shiratori Y, et al. In vivo selective gene expression and therapy mediated by adenoviral vectors for human carcinoembryonic antigen-producing gastric carcinoma. Cancer Res 1997;57:427984.[Abstract/Free Full Text]
- Dmitriev I, Kashentseva E, Rogers BE, Krasnykh V, Curiel DT. Ectodomain of coxsackievirus and adenovirus receptor genetically fused to epidermal growth factor mediates adenovirus targeting to epidermal growth factor receptor-positive cells. J Virol 2000;74:687584.[Abstract/Free Full Text]
- Watkins SJ, Mesyanzhinov VV, Kurochkina LP, Hawkins RE. The "adenobody" approach to viral targeting: specific and enhanced adenoviral gene delivery. Gene Ther 1997;4:100412.[CrossRef][Medline]
- Nettelbeck DM, Miller DW, Jerome V, et al. Targeting of adenovirus to endothelial cells by a bispecific single-chain diabody directed against the adenovirus fiber knob domain and human endoglin (CD105). Mol Ther 2001;3:88291.[CrossRef][Medline]
- Haisma HJ, Pinedo HM, Rijswijk A, et al. Tumor-specific gene transfer via an adenoviral vector targeted to the pan-carcinoma antigen EpCAM. Gene Ther 1999;6:146974.[CrossRef][Medline]
- Kashentseva EA, Seki T, Curiel DT, Dmitriev IP. Adenovirus targeting to c-erbB-2 oncoprotein by single-chain antibody fused to trimeric form of adenovirus receptor ectodomain. Cancer Res 2002;62:60916.[Abstract/Free Full Text]