Table 1

Amino acid sequences of COOH-terminal regions of human VIP/PACAP receptors

VPAC1 (438–457)ATCSTQVSMLTRVSPGARRSSSFQAEVSLV *
VPAC2 (419–438)SFSRNGSEGALQFHRGSRAQSFLQTETSVI
PAC1 (506–525)SGVNGGTQLSLSKSSSQIRMSGLPADNLAT
  • * Amino acid sequences of peptides corresponding to COOH-terminal regions used to immunize rabbits for antibody production are underlined.

  • This sequence is identical in all known PAC1 splice variants.