Table 1.

Predicted poly-HLA-DR–binding peptides derived from MAGE-A6

PeptideSequenceHLA-DR alleles predicted to bind peptide (%)
MAGE-A6140-170VGNWQYFFPVIFSKASDSLQLVFGIELMEVDDRB1*01, *03, *04, *07, *13, *15; DRB5*01; (80)
MAGE-A6172-187IGHVYIFATCLGLSYDDRB1*01, *04, *07, *08, *11, *13, *15; DRB5*01; (80)
MAGE-A6192-214DNQIMPKTGFLIILAIIAKEGDDRB1*01, *03, *04, *07, *08, *11, *13, *15; DRB5*01; (84)
MAGE-A6280-302ETSYVKVLHHMVKISGGPRISYPDRB1*01, *03, *07, *08, *11, *13, *15; DRB5*01; (78)